"event" : "MessagesWidgetCommentForm", ] { }, "useCountToKudo" : "false", "revokeMode" : "true", "action" : "rerender" "event" : "MessagesWidgetCommentForm", "quiltName" : "ForumMessage", ] "actions" : [ "event" : "MessagesWidgetEditCommentForm", "disableLabelLinks" : "false", }, { }, } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); { ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } }, "entity" : "2364323", "action" : "rerender" "context" : "", ', 'ajax'); "}); "context" : "", ] ] { "action" : "rerender" Secure the motor to the motor box using the hardware back side of the fi rewall. "event" : "QuickReply", }, "action" : "rerender" "eventActions" : [ "action" : "rerender" "context" : "", }, "disableLinks" : "false", "event" : "removeMessageUserEmailSubscription", "action" : "rerender" "event" : "MessagesWidgetAnswerForm", { "actions" : [ Work Position. }, // Oops, not the right sequence, lets restart from the top. LITHIUM.AjaxSupport.ComponentEvents.set({ ] }, "useSubjectIcons" : "true", { }); { { "context" : "", "event" : "unapproveMessage", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "actions" : [ { { LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] // enable redirect to login page when "logmein" is typed into the void =) Ich hatte bislang die Horizon Box genutzt und auch dort lagen Down und Up Stream immer Stabil und in mindestens voller Kapazität an. if ( neededkeys[count] == key ) { { ] "event" : "MessagesWidgetAnswerForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "actions" : [ "event" : "markAsSpamWithoutRedirect", LITHIUM.Dialog.options['-1928001242'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, "displayStyle" : "horizontal", { "displayStyle" : "horizontal", { }, "actions" : [ "actions" : [ "quiltName" : "ForumMessage", "displayStyle" : "horizontal", { { "disallowZeroCount" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" ] "context" : "", "action" : "rerender" ] } "actions" : [ "}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "message" : "2364329", ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "initiatorDataMatcher" : "data-lia-message-uid" }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetAnswerForm", "forceSearchRequestParameterForBlurbBuilder" : "false", . "action" : "rerender" ] { { "actions" : [ "actions" : [ LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2364323}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2364325}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2364324}},{"elementId":"link_24","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2364325}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2364326}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2364327}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2364328}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2364329}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2459463}},{"elementId":"link_44","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2513747}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2525974}},{"elementId":"link_46","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2540369}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519324}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543642}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543611}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543588}},{"elementId":"link_53","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543515}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543376}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543372}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543343}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543287}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543269}},{"elementId":"link_59","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543219}}]); { "kudosable" : "true", "context" : "envParam:feedbackData", "actions" : [ "event" : "ProductMessageEdit", ], "context" : "", "}); } "action" : "addClassName" "actions" : [ }); "actions" : [ }, }, "actions" : [ }, "actions" : [ "actions" : [ "context" : "envParam:feedbackData", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,message", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "selector" : "#messageview_2", { } }); .attr('aria-selected','false'); "selector" : "#kudosButtonV2_6", "actions" : [ "context" : "", "context" : "envParam:feedbackData", "context" : "", }, "quiltName" : "ForumMessage", { "context" : "", { "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ ;(function($) { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2364326,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "ProductAnswerComment", "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2364329 .lia-rating-control-passive', '#form_6'); "entity" : "2364328", "context" : "", "parameters" : { "quiltName" : "ForumMessage", }, $('li.close-on-click').on('click',resetMenu); { { }); { "context" : "", return; "actions" : [ "showCountOnly" : "false", } }, { ], var watching = false; "parameters" : { "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:quiltName,message", $(document).ready(function(){ "truncateBody" : "true", "kudosLinksDisabled" : "false", }, "selector" : "#messageview_2", { "dialogKey" : "dialogKey" })(LITHIUM.jQuery); Bist du sicher, dass du fortfahren möchtest? "activecastFullscreen" : false, LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, '5QL37rP85nVUMH77LYt3hQPo6ZEBNhZ4cWT26WY9X9A. "event" : "addMessageUserEmailSubscription", { "actions" : [ }, }); { { }, { ] "action" : "rerender" { ] "context" : "", { } "event" : "addThreadUserEmailSubscription", "event" : "deleteMessage", Bist du sicher, dass du fortfahren möchtest? "truncateBodyRetainsHtml" : "false", } "context" : "envParam:quiltName,message", ... USA BOX. "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", { ] "action" : "rerender" { }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); "parameters" : { "actions" : [ "context" : "envParam:quiltName", "displayStyle" : "horizontal", ] "actions" : [ "actions" : [ "initiatorBinding" : true, ] }, "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" } { ] ] "action" : "rerender" { }); Rotary International is an international service organization whose stated purpose is to bring together business and professional leaders in order to provide humanitarian service and to advance goodwill and peace around the world. "revokeMode" : "true", "action" : "rerender" element.removeClass('active'); }, Local Business. { "useSimpleView" : "false", "event" : "ProductMessageEdit", { ] // Reset the conditions so that someone can do it all again. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ }, "action" : "rerender" "event" : "MessagesWidgetCommentForm", { { ] LITHIUM.Loader.runJsAttached(); } "action" : "rerender" ] { "action" : "rerender" "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2364323 .lia-rating-control-passive', '#form'); // If watching, pay attention to key presses, looking for right sequence. { "action" : "rerender" ] "actions" : [ { }, } if (element.hasClass('active')) { }, } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); } ] "action" : "rerender" { { "context" : "", "action" : "rerender" { ] }); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } { } ] }, } { { "disableKudosForAnonUser" : "false", watching = true; ], "initiatorBinding" : true, "eventActions" : [ } { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" "actions" : [ "actions" : [ "truncateBodyRetainsHtml" : "false",