{ { "actions" : [ if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") ] "event" : "markAsSpamWithoutRedirect", LITHIUM.AjaxSupport.ComponentEvents.set({ ] { } })(LITHIUM.jQuery); "kudosable" : "true", "event" : "QuickReply", { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_54","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditCommentForm", LITHIUM.AjaxSupport.ComponentEvents.set({ ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "event" : "ProductMessageEdit", { "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1682273 .lia-rating-control-passive', '#form_6'); } LITHIUM.AjaxSupport.ComponentEvents.set({ o.innerHTML = "Page number must be 1 or greater. { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); { "actions" : [ { LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "lia-deleted-state", LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "addClassName" { "disableLinks" : "false", { "truncateBodyRetainsHtml" : "false", "context" : "envParam:quiltName", "eventActions" : [ }, LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); } "actions" : [ "action" : "rerender" { "disableLabelLinks" : "false", "showCountOnly" : "false", element.find('ul').slideUp(); "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", "}); "revokeMode" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); "displayStyle" : "horizontal", } }, "initiatorBinding" : true, "context" : "envParam:feedbackData", } }, }, }, { } LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); }, ] { }, { } ', 'ajax'); { "actions" : [ { "truncateBody" : "true", "disableLinks" : "false", "actions" : [ }, { LITHIUM.AjaxSupport.useTickets = false; "event" : "addMessageUserEmailSubscription", }, } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); // Oops. }); { }, "action" : "rerender" } I then read this post and obviously there's a problem. "actions" : [ "action" : "addClassName" "displayStyle" : "horizontal", "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivKIP/thread-id/74551","ajaxErrorEventName":"LITHIUM:ajaxError","token":"xh7r32CZ97008H1G1R1pzT3DjWUNGK6MGpvqpfVCQdg. "componentId" : "forums.widget.message-view", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1682164 .lia-rating-control-passive', '#form_2'); "selector" : "#messageview_6", "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'Ruh6V0IRH0r2MAcnrAYCX6tg3M_ObU-0zvMRmE1tyW0. { "action" : "rerender" } } { "event" : "addThreadUserEmailSubscription", ] ] { "action" : "rerender" "action" : "rerender" }, "actions" : [ "event" : "kudoEntity", "actions" : [ "parameters" : { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); "context" : "", "event" : "MessagesWidgetAnswerForm", { "selector" : "#kudosButtonV2_7", }, { }); }, ] "initiatorBinding" : true, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ ] } } "event" : "MessagesWidgetMessageEdit", } return false; { { "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName,expandedQuiltName", "message" : "1682363", { "action" : "rerender" ] ] { "action" : "pulsate" { { "actions" : [ "event" : "ProductAnswerComment", // Set start to true only if the first key in the sequence is pressed ] "event" : "unapproveMessage", "action" : "rerender" ] "context" : "", That would give you double NAT which is not to bad if you don't have any incoming connections needing port forwarding. }, "messageViewOptions" : "1111110111111111111110111110100101001101" ] "context" : "", "context" : "envParam:quiltName,message,product,contextId,contextUrl", } ] ] LITHIUM.Auth.CHECK_SESSION_TOKEN = 'gdeEo3TibAyFjQO1jlLEhiM_8srliUdFgl465qgsj50. { "context" : "", "action" : "rerender" }, "action" : "rerender" { "context" : "lia-deleted-state", } { Moderator edit: Bridge mode is dus niet beschikbaar. "actions" : [ { ] { "truncateBody" : "true", { { "action" : "rerender" "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); ] "actions" : [ "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_51","feedbackSelector":".InfoMessage"}); }, LITHIUM.AjaxSupport.ComponentEvents.set({ { "action" : "rerender" "action" : "rerender" "actions" : [ }, }, "event" : "approveMessage", "context" : "", { { if(1 < 2){ ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivKIP/thread-id/74551","ajaxErrorEventName":"LITHIUM:ajaxError","token":"xh7r32CZ97008H1G1R1pzT3DjWUNGK6MGpvqpfVCQdg. }); } $(this).toggleClass('active'); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "actions" : [ { "action" : "rerender" { } } "event" : "deleteMessage", "actions" : [ "event" : "expandMessage", "event" : "MessagesWidgetMessageEdit", "event" : "addMessageUserEmailSubscription", LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } ] ], ] }, LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "MessagesWidgetEditCommentForm", })(LITHIUM.jQuery); } "useCountToKudo" : "false", LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, '0iW3o-zMPKGg5D5VTjjwZb2bVnfIqvf9t62KCQ9eOo0. { }, "event" : "markAsSpamWithoutRedirect", "action" : "addClassName" "event" : "deleteMessage", "componentId" : "kudos.widget.button", ] "initiatorBinding" : true, "context" : "envParam:entity", "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" "actions" : [ $(document).ready(function(){ "event" : "ProductAnswerComment", ] "action" : "rerender" "event" : "MessagesWidgetAnswerForm", count = 0; "displayStyle" : "horizontal", { } "actions" : [ "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ // Oops, not the right sequence, lets restart from the top. "context" : "", "action" : "rerender" "displayStyle" : "horizontal", } { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; }, "event" : "removeMessageUserEmailSubscription", { ] "includeRepliesModerationState" : "false", } "event" : "expandMessage", "context" : "lia-deleted-state", "context" : "envParam:quiltName,message,product,contextId,contextUrl", } "action" : "rerender" }, "event" : "MessagesWidgetMessageEdit", } }, "action" : "rerender" "actions" : [ "accessibility" : false, "event" : "MessagesWidgetEditAnswerForm", "context" : "", "selector" : "#kudosButtonV2_7", ;(function($) { }, ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivKIP/thread-id/74551","ajaxErrorEventName":"LITHIUM:ajaxError","token":"kszi8zz-NLisevRndwYMTEzPsz8UzVyInlxRUYrLL7Q. "displaySubject" : "true", $(document).ready(function(){ }, "event" : "MessagesWidgetAnswerForm", } ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditAnswerForm", } ] LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); { }, { "parameters" : { "selector" : "#messageview", }, "showCountOnly" : "false", "actions" : [ { } ] "event" : "removeThreadUserEmailSubscription", }, { "action" : "rerender" // console.log(key); "context" : "", "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" "componentId" : "kudos.widget.button", "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "AcceptSolutionAction", "truncateBodyRetainsHtml" : "false", ] LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); { "displaySubject" : "true", { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1682164,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "useTruncatedSubject" : "true", // We're good so far. "action" : "pulsate" } "action" : "pulsate" "action" : "rerender" "actions" : [ }, } "event" : "markAsSpamWithoutRedirect", "action" : "pulsate" "context" : "envParam:quiltName", "actions" : [ ', 'ajax'); "event" : "markAsSpamWithoutRedirect", "initiatorBinding" : true, "actions" : [ "action" : "rerender" "includeRepliesModerationState" : "false", "action" : "rerender" document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); "event" : "markAsSpamWithoutRedirect", "action" : "rerender" { "useTruncatedSubject" : "true", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", if (doChecks(pagerId, val)) "action" : "rerender" "action" : "pulsate" "actions" : [ { { "event" : "ProductAnswerComment", } "action" : "rerender" { { "event" : "editProductMessage", "selector" : "#kudosButtonV2_9", { ] "eventActions" : [ }, } } o.innerHTML = "Page number can\'t exceed 2. "actions" : [ ] "context" : "", { LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); "context" : "", "event" : "ProductAnswerComment", { } }, "actions" : [ "context" : "", ', 'ajax'); { "event" : "ProductMessageEdit", }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_9', 'kudoEntity', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {}, 'a0Ac8H4o_E8fGZtGtNPLdR4f7RCPl_4YdD8OfUkoIJw. "action" : "rerender" { { { { // enable redirect to login page when "logmein" is typed into the void =) }, ] "actions" : [ clearWarning(pagerId); { { "truncateBody" : "true", } "useTruncatedSubject" : "true", "context" : "envParam:quiltName,message,product,contextId,contextUrl", } { }, "context" : "", "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" "quiltName" : "ForumMessage", { window.scrollTo(0,position_x.top - 150); "useSubjectIcons" : "true", } // just for convenience, you need a login anyways... $(document).ready(function(){ ] } ] "event" : "MessagesWidgetEditAnswerForm", ;(function($) { "event" : "MessagesWidgetCommentForm", { "context" : "", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); "actions" : [ "actions" : [ "event" : "unapproveMessage", "context" : "envParam:entity", "actions" : [ "quiltName" : "ForumMessage", "action" : "rerender" ] "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ if ( watching ) { ] }); } "event" : "MessagesWidgetEditAnswerForm", "event" : "MessagesWidgetMessageEdit", } ] } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/74551","ajaxErrorEventName":"LITHIUM:ajaxError","token":"sy1g1ZN2foRQ7t0cgS44Db4k41fdF7ij2fh_wdWmCT0. { ] }, "context" : "", "useSubjectIcons" : "true", "context" : "envParam:quiltName", } "showCountOnly" : "false", }, LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "action" : "rerender" } }, "action" : "rerender" }, $(document).ready(function(){ { ] // We made it! } "action" : "rerender" }, }); "actions" : [ "context" : "",