"showCountOnly" : "false", "actions" : [ }, "truncateBodyRetainsHtml" : "false", "event" : "ProductAnswerComment", element.siblings('li').removeClass('active'); "actions" : [ "useCountToKudo" : "false", }, ] { } "actions" : [ ] } ] "}); { { { "actions" : [ "actions" : [ "actions" : [ "actions" : [ ] lithstudio: [], "initiatorBinding" : true, // --> "useSimpleView" : "false", } count = 0; } "truncateBody" : "true", "actions" : [ ] o.innerHTML = ""; var count = 0; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); } "useCountToKudo" : "false", { "context" : "envParam:selectedMessage", "actions" : [ ] // console.log(key); o.innerHTML = ""; }, }, "context" : "", "event" : "MessagesWidgetEditCommentForm", } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "removeMessageUserEmailSubscription", "context" : "", { "linkDisabled" : "false" function disableInput(pagerId) { } "context" : "", disableInput(pagerId); "event" : "expandMessage", } "action" : "rerender" }, { "context" : "", "displayStyle" : "horizontal", { }, "}); { "action" : "rerender" { "actions" : [ }, "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); "displayStyle" : "horizontal", { "actions" : [ "message" : "2360277", "buttonDialogCloseAlt" : "Schließen", { "}); // Reset the conditions so that someone can do it all again. "kudosable" : "true", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); ] "action" : "rerender" "quiltName" : "ForumMessage", "initiatorDataMatcher" : "data-lia-message-uid" { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "actions" : [ "event" : "MessagesWidgetCommentForm", { "}); }, "action" : "rerender" LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; { "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ "componentId" : "kudos.widget.button", $(document).ready(function(){ }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } //} else { "defaultAriaLabel" : "", "event" : "MessagesWidgetCommentForm", }, ] { "event" : "markAsSpamWithoutRedirect", "dialogContentCssClass" : "lia-panel-dialog-content", if ( !watching ) { .attr('aria-expanded','false') "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" }); "action" : "rerender" "disableKudosForAnonUser" : "false", "context" : "", ] ] "parameters" : { "truncateBodyRetainsHtml" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/317490","ajaxErrorEventName":"LITHIUM:ajaxError","token":"NJ-_tM_n0FHkQNpKFXmH34LHqz9u03veZ-zMjZ3NZGI. ] "selector" : "#messageview_4", "useTruncatedSubject" : "true", "event" : "unapproveMessage", "context" : "", "context" : "", "actions" : [ "event" : "editProductMessage", "context" : "", } { "actions" : [ if ( key == neededkeys[0] ) { element.addClass('active'); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); { LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ "action" : "rerender" }, "selector" : "#kudosButtonV2_4", "disallowZeroCount" : "false", "action" : "rerender" "context" : "envParam:entity", "useCountToKudo" : "false", "actions" : [ "useCountToKudo" : "false", "actions" : [ } }, { }, "context" : "", { { } ] }, "event" : "MessagesWidgetAnswerForm", }, "event" : "MessagesWidgetEditCommentForm", ] { "context" : "envParam:quiltName,expandedQuiltName", "event" : "ProductAnswer", } ] "actions" : [ { "entity" : "2360275", "includeRepliesModerationState" : "false", "context" : "envParam:quiltName,message", count = 0; "linkDisabled" : "false" } { Bist du sicher, dass du fortfahren möchtest? "context" : "", }); } "action" : "rerender" { "disableLabelLinks" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ } Versuchen Sie es nach der Verbindungsherstellung erneut. "context" : "", ] "context" : "envParam:selectedMessage", { LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ "actions" : [ } } { "forceSearchRequestParameterForBlurbBuilder" : "false", { ] Anela85: ich hatte auch beim kundenservice angerufen dort wurde mir beschrieben das ich meine box 10 sekunden ausschalten soll und dann auf der box mein daumen auf dem - button halten soll bis 2 mal ein willkommens bildschirm auftaucht dies passierte auch aber es hat sich dennoch nichts geändert der fehler bleibt bestehen, in dem brief denn ich bekam wurde mir geschrieben ich hätte nur telefon und internet anschluss obwohl ich mit TV gebucht hatte. Konfigurationsprobleme stören dann auch die Fernseh-Funktionaliät. } LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); }, "useSimpleView" : "false", } Wir zeigen Ihnen, was Sie tun sollten. } }, } "actions" : [ { }, }, "context" : "lia-deleted-state", ] ] "useSimpleView" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); }, ] { "disableKudosForAnonUser" : "false", "disableLabelLinks" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" } ] clearWarning(pagerId); "includeRepliesModerationState" : "false", { "event" : "addMessageUserEmailSubscription", "event" : "editProductMessage", } "action" : "rerender" } "actions" : [ LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2360270 .lia-rating-control-passive', '#form_0'); "actions" : [ ], "action" : "rerender" count = 0; "context" : "", "parameters" : { { "action" : "rerender" }, "action" : "rerender" { $('.community-menu').removeClass('active') { if ( watching ) { "truncateBodyRetainsHtml" : "false", } { "actions" : [ { "event" : "addThreadUserEmailSubscription", { { { }, "context" : "", "action" : "rerender" "actions" : [ "action" : "rerender" "action" : "rerender" }, $(document).keydown(function(e) { { }, { }, { "action" : "rerender" "linkDisabled" : "false" }); ] ', 'ajax'); } { } "context" : "envParam:entity", LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } } LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'W8FUHb4dtSrOYhHkMp6-T16_U3-aCl47vGH2XknKzag. "displayStyle" : "horizontal", LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "QuickReply", "action" : "rerender" "actions" : [ ] "event" : "MessagesWidgetMessageEdit", "actions" : [ "componentId" : "forums.widget.message-view", { "event" : "AcceptSolutionAction", "action" : "rerender" "event" : "deleteMessage", "actions" : [ ] }, }, "event" : "ProductAnswerComment", "context" : "", "event" : "MessagesWidgetMessageEdit", }); { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "actions" : [ ] } }, "disableLinks" : "false", "context" : "", "actions" : [ }, } { { }, } "action" : "rerender" "event" : "markAsSpamWithoutRedirect", } ] } "actions" : [ { "action" : "rerender" } "action" : "rerender" "action" : "rerender" "context" : "", { { }, "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" "context" : "", "triggerEvent" : "click", "action" : "rerender" ] }, "dialogContentCssClass" : "lia-panel-dialog-content", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'Ihx4FUFs_7BYOBFcTS3M83Ymv6ues2FeGRIw9E0GgFw. "action" : "rerender" "action" : "rerender" }, ] ] "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); ', 'ajax'); { { ] ] "parameters" : { "action" : "rerender" "includeRepliesModerationState" : "false", "action" : "pulsate" $(document).ready(function(){ // console.log('watching: ' + key); { "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ ;(function($) { { }, "componentId" : "forums.widget.message-view", "context" : "", "actions" : [ "actions" : [ "action" : "rerender" "event" : "AcceptSolutionAction", }, "action" : "rerender" }, "context" : "lia-deleted-state", Bist du sicher, dass du fortfahren möchtest? "actions" : [ } "event" : "ProductAnswerComment", "context" : "envParam:quiltName", "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", "action" : "rerender" "context" : "", "action" : "pulsate" { "initiatorBinding" : true, element.siblings('li').find('li').removeClass('active'); o.innerHTML = "Page number must be 1 or greater. return; setWarning(pagerId); "action" : "rerender" } { "event" : "addMessageUserEmailSubscription", } { "eventActions" : [ if ( key == neededkeys[0] ) { { ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); { ], "context" : "", "useCountToKudo" : "false", "actions" : [ LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "message" : "2360273", "disallowZeroCount" : "false", "action" : "pulsate" "event" : "expandMessage", "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", { "context" : "envParam:quiltName", "context" : "envParam:quiltName", "action" : "rerender" } "accessibility" : false, } { "dialogKey" : "dialogKey" "context" : "", }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); } "action" : "rerender" { "event" : "ProductMessageEdit", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2360276 .lia-rating-control-passive', '#form_6'); "event" : "RevokeSolutionAction", } "context" : "", { }, { "action" : "rerender" { }); "action" : "rerender" }, }, { { }, "actions" : [ "message" : "2360277", .attr('aria-hidden','false') LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); } $(document).ready(function(){ }, var handleClose = function(event) { Commission to invest €11 billion in new solutions for societal challenges and drive innovation-led sustainable growth. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "envParam:quiltName,expandedQuiltName", .attr('aria-selected','false'); "actions" : [ "context" : "", { "action" : "rerender" "actions" : [ "actions" : [ "}); "actions" : [ "useTruncatedSubject" : "true", "action" : "rerender" { "action" : "rerender" "disableKudosForAnonUser" : "false", "truncateBodyRetainsHtml" : "false", "context" : "envParam:entity", "actions" : [ "action" : "rerender" } "event" : "kudoEntity", "messageViewOptions" : "1111110111111111111110111110100101001101" { { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetMessageEdit", { { "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ], "action" : "rerender" "linkDisabled" : "false" // just for convenience, you need a login anyways... { "event" : "MessagesWidgetEditCommentForm", "useSubjectIcons" : "true", "event" : "editProductMessage", "action" : "rerender" LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); } "event" : "ProductAnswerComment", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/317490","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ca4JQGYcnIqYUsL4-bFqL5zr0ytz54tmT_nOqiGuoqU. "action" : "rerender" { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { ] } setWarning(pagerId); }, "event" : "approveMessage", "context" : "", { LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", if ( Number(val) > 2 ) { "useCountToKudo" : "false", }); Vermögen und Gage, TV: Kein Signal - die häufigsten Ursachen und Lösungen, Blindenton ausschalten: So deaktivieren Sie die Audiodeskription am TV, Grundsätzlich gilt: folgen Sie den angezeigten Anweisungen auf dem Display Ihres Receivers und merken Sie sich den Fehlercode. LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "initiatorBinding" : true, "action" : "rerender" logmein: [76, 79, 71, 77, 69, 73, 78], { }, "event" : "approveMessage", ] { "actions" : [ "action" : "pulsate" ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2360278 .lia-rating-control-passive', '#form_8'); "action" : "rerender" { "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:selectedMessage", { "actions" : [ "action" : "rerender" var keycodes = { }, "context" : "", $('.css-menu').removeClass('cssmenu-open') { "action" : "rerender" { "kudosLinksDisabled" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "context" : "envParam:quiltName,product,contextId,contextUrl", }, { "actions" : [ "initiatorBinding" : true, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); "action" : "rerender" { LITHIUM.AjaxSupport.ComponentEvents.set({ } { } { "event" : "expandMessage", var ctaHTML = '. { ] "disallowZeroCount" : "false", { }, return false; ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "disableLinks" : "false", }, ] { "context" : "", "actions" : [ "event" : "ProductAnswerComment", "action" : "rerender" "activecastFullscreen" : false, "event" : "MessagesWidgetMessageEdit", "action" : "rerender" "; ] ] "action" : "rerender" "actions" : [ { "action" : "addClassName" ] } "actions" : [ } }, } { "action" : "rerender" ;(function($) { "actions" : [ { { "eventActions" : [ $(document).ready(function(){ { "actions" : [ { ] ] var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "actions" : [ ] "parameters" : { { { "eventActions" : [ event.stopPropagation(); o.innerHTML = "Page number must be 1 or greater. } "parameters" : { "kudosLinksDisabled" : "false", ], "actions" : [ "action" : "rerender" { { { { ] }, }); // console.log(key); "context" : "", { }, "useSubjectIcons" : "true", { { { "includeRepliesModerationState" : "false", } }, "action" : "rerender" }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/317490","ajaxErrorEventName":"LITHIUM:ajaxError","token":"yrOQ2scWnoPfxy3kt9gyHw6fllDJqTW32BvEezWgJks. "actions" : [ }, "initiatorDataMatcher" : "data-lia-kudos-id" { "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? } "actions" : [ ] ] "context" : "envParam:feedbackData", "actions" : [ "event" : "kudoEntity", "event" : "editProductMessage", ] "linkDisabled" : "false" "action" : "rerender" { // If watching, pay attention to key presses, looking for right sequence. }, { }); { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:quiltName", "action" : "rerender" "event" : "ProductAnswerComment", "kudosable" : "true",