return; { "actions" : [ ] "event" : "addThreadUserEmailSubscription", ] ctaHTML += 'Stell Deine Frage'; { "actions" : [ ], LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2089845 .lia-rating-control-passive', '#form'); "disableKudosForAnonUser" : "false", "actions" : [ "action" : "pulsate" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/157062","ajaxErrorEventName":"LITHIUM:ajaxError","token":"HfAPdpauCvALFIx3w9bUqyqtposPA518XvAMe0AxjC4. "showCountOnly" : "false", } "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); count = 0; "event" : "editProductMessage", "action" : "rerender" var watching = false; }, } "context" : "lia-deleted-state", "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", createStorage("false"); LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; //$('#lia-body').addClass('lia-window-scroll'); "}); "event" : "markAsSpamWithoutRedirect", "action" : "rerender" } LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233276}); "action" : "rerender" "actions" : [ ] "eventActions" : [ "dialogContentCssClass" : "lia-panel-dialog-content", }, Kombiniere GigaTV Cable oder Horizon TV Cable mit einem Red Internet & Phone Tarif und Du sparst monatlich 5 Euro. } })(LITHIUM.jQuery); // Pull in global jQuery reference $(this).removeAttr('href'); element.children('ul').slideDown(); { } }, lithstudio: [], "action" : "rerender" // Reset the conditions so that someone can do it all again. } "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); Sobald du angemeldet bist, kannst du auf unserer Seite aktiv teilnehmen, indem du deine eigenen Themen und Beiträge erstellst und dich über deinen eigenen Posteingang mit anderen Mitgliedern unterhalten kannst! "event" : "ProductAnswerComment", "entity" : "2090138", ] { "action" : "rerender" var resetMenu = function() { ;(function($) { } "action" : "rerender" "actions" : [ LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_38c8ede06f5e43","nodesModel":{"123456|forum-board":{"title":"Board-Suche: Internet, Telefon & TV über Kabel","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Internet, Telefon & TV über Kabel","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: Internet, Telefon & TV über Kabel","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_38c8ede06f5e43_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); { }, "initiatorBinding" : true, }); { } "action" : "rerender" "action" : "rerender" "context" : "", Bei VF-West (Unitymedia) funktioniert das nur, wenn du Powerupload gebucht hast und dann musst es es beim Support anfordern. { "context" : "lia-deleted-state", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "action" : "rerender" "actions" : [ { "eventActions" : [ // just for convenience, you need a login anyways... LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2089941,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. 40. var neededkeys = [76, 79, 71, 77, 69, 73, 78]; welche Angebote gibt es aktuell, die man evtl. ctaHTML += ', Angebote und Informationen für CallYa Kunden, Störungsmeldungen Internet, TV & Telefon DSL, Störungsmeldungen Internet, TV & Telefon Kabel, Störungsmeldungen Mobilfunk, CallYa & LTE, Angebote Vertragsverlängerung bei unitymedia, Diesen Thema für aktuellen Benutzer floaten, Selfservice-MeinVodafone-App-Quick-Check-Verbrauchsabfrage, Betreff: Angebote Vertragsverlängerung bei unitymedia, Wichtig! LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/157062","ajaxErrorEventName":"LITHIUM:ajaxError","token":"HfAPdpauCvALFIx3w9bUqyqtposPA518XvAMe0AxjC4. "actions" : [ ] ;(function($) { // We made it! .attr('aria-expanded','false') AW: Unitymedia - Kündigung, Rückholangebote, Erfahrungswerte? ], ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_38c8ede06f5e43_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/123456/thread-id/157062&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "closeEvent" : "LITHIUM:lightboxCloseEvent", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); "context" : "", { "actions" : [ "context" : "envParam:quiltName,message", "buttonDialogCloseAlt" : "Schließen", "actions" : [ "event" : "addMessageUserEmailSubscription", { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); "context" : "", }, }, $(this).removeClass('active'); "event" : "RevokeSolutionAction", Vehicle classification . $(this).addClass('active') $(this).next().toggle(); } // console.log(key); "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); } lithadmin: [] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2090138,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.Dialog.options['1525265189'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "revokeMode" : "true", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } LITHIUM.Auth.CHECK_SESSION_TOKEN = 'Zbgt_GvZ-ehOK2qrR_WhNvrDcCfdsuQNRcrPonknUVg. { } "context" : "envParam:quiltName", "event" : "deleteMessage", }, }, "context" : "envParam:entity", $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { LITHIUM.Dialog({ ] "actions" : [ // We're good so far. } "event" : "AcceptSolutionAction", { } else { ] { "action" : "pulsate" "action" : "rerender" "event" : "MessagesWidgetAnswerForm", "context" : "", $('#vodafone-community-header .lia-search-toggle').click(function() { Demzufolge werden an den Terminen im April 2021 (wir berichteten) wie bereits im Forum spekuliert zahlreiche Pay-TV-Sender abgeschaltet. } CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); } expireDate.setDate(expireDate.getDate() + 365*10); ] LITHIUM.AjaxSupport.useTickets = false; }, "context" : "envParam:selectedMessage", { Help forums to describe problems and ask questions The Help Forums are organized into a series of sub-forums that address … { "actions" : [ { } }); "event" : "MessagesWidgetEditAnswerForm", "actions" : [ { ] ], "action" : "rerender" "event" : "removeMessageUserEmailSubscription", "action" : "addClassName" Bei diesem Tarif ist mehr Bandbreite für den selben Preis enthalten. "event" : "addThreadUserEmailSubscription", "action" : "rerender" "context" : "envParam:feedbackData", "displayStyle" : "horizontal", "context" : "envParam:selectedMessage", { { } "action" : "addClassName" { LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233276}); "event" : "MessagesWidgetEditAnswerForm", "actions" : [ ] "actions" : [ { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" }; LITHIUM.DropDownMenu({"menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","menuOpenCssClass":"dropdownHover","clickElementSelector":".lia-js-click-menu","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened"}); ] $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); "context" : "envParam:quiltName,message", "event" : "ProductAnswer", { "disallowZeroCount" : "false", "action" : "rerender" ] var notifCount = 0; "event" : "MessagesWidgetCommentForm", "action" : "rerender" "actions" : [ { Based on their specific characteristics, they are divided into three categories - Premium, Comfort and Standard - in order to best meet the needs of the customers. ] { { ... Soweit ist er mit Unitymedia zufrieden und würde ungern wechseln, da so ein Wechsel nicht immer reibungslos klappt. { "quiltName" : "ForumMessage", //$('#community-menu-toggle').removeClass('active') }, "context" : "", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ zu Unitymedia? "truncateBodyRetainsHtml" : "false", { { "actions" : [ "actions" : [ var neededkeys = [76, 79, 71, 77, 69, 73, 78]; } Die Anklopfen-Funktion ist bei Ihrem Anschluss standardmäßig immer eingeschaltet. { LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); "action" : "rerender" } Dez 2020, 16:22. }, "action" : "rerender" // We made it! } "context" : "", ] "dialogContentCssClass" : "lia-panel-dialog-content", Wir beraten dich kostenlos undunterstützen bei deiner Bestellung. Sprich mit einem unserer Experten. })(LITHIUM.jQuery); "action" : "rerender" { "event" : "kudoEntity", LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "messageViewOptions" : "1111110111111111111110111110100101011101" "kudosLinksDisabled" : "false", { "event" : "unapproveMessage", ] Das inoffizielle Vodafone-Kabel-Forum ist eine Support- und Diskussionsplattform rund um den Kabelnetzbetreiber Vodafone Kabel Deutschland bzw. "context" : "", } "actions" : [ } { { "context" : "", { "action" : "rerender" }, LITHIUM.Dialog.options['1525265189'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "action" : "rerender" } }); var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); Moderator: Team. "event" : "removeMessageUserEmailSubscription", ', 'ajax'); "linkDisabled" : "false" "includeRepliesModerationState" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ LOVOO is the place for chatting and getting to know people. ] "actions" : [ var key = e.keyCode; "context" : "envParam:quiltName", })(LITHIUM.jQuery); { Netzwerke und Internet. "event" : "addThreadUserEmailSubscription", }, ] "event" : "removeThreadUserEmailSubscription", "context" : "", var expireDate = new Date(); } else { } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "removeMessageUserEmailSubscription", }, "action" : "pulsate" "}); } "}); { LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); logmein: [76, 79, 71, 77, 69, 73, 78], "revokeMode" : "true", "context" : "", "componentId" : "forums.widget.message-view", "}); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2090138 .lia-rating-control-passive', '#form_1'); Unitymedia). { "action" : "rerender" "event" : "RevokeSolutionAction", { }; }); }); "event" : "removeMessageUserEmailSubscription", ] } LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ ;(function($){ "truncateBodyRetainsHtml" : "false", "actions" : [ $(this).next().toggle(); }); } } From global brands to local stands, eBay connects millions of buyers and sellers around the world, empowering people and creating opportunity for all. "context" : "", { //} else { $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() "action" : "rerender" "action" : "rerender" "action" : "rerender" "actions" : [ Also das mit den 25 Euro kann man mehrmals während der Laufzeit machen. "accessibility" : false, "event" : "RevokeSolutionAction", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" // Oops, not the right sequence, lets restart from the top. "buttonDialogCloseAlt" : "Schließen", "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:quiltName,product,contextId,contextUrl", "useSubjectIcons" : "true", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } "useSubjectIcons" : "true", $(this).toggleClass("view-btn-open view-btn-close"); })(LITHIUM.jQuery); }, "context" : "envParam:selectedMessage", "actions" : [ "closeEvent" : "LITHIUM:lightboxCloseEvent", } "actions" : [ }); Die Unitymedia / Kabel BW 3play Tarife sind in vielen Teilen von Hessen, Nordrhein-Westfalen (NRW) und Baden-Württemberg verfügbar (Highspeed andere Bundesländer HIER).Die Unitymedia 3play Angebote werden über das Kabelnetz und nicht über das Telefonnetz realisiert, daher kann Unitymedia 3play auch dort möglich sein, wo kein DSL oder VDSL verfügbar ist! LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/157062","ajaxErrorEventName":"LITHIUM:ajaxError","token":"lCqnoDet0MFirfS8Qe0Bacx17SJSvOLbZjw8lRqCFuk. "actions" : [ }, Chris. }, var element = $(this).parent('li'); Vodafone West (ehem. "messageViewOptions" : "1111110111111111111110111110100101001101" "kudosable" : "true", $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { }, var notifCount = 0; "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); { "displayStyle" : "horizontal", ] $(this).toggleClass("view-btn-open view-btn-close"); $(this).toggleClass('active'); "event" : "approveMessage", "selector" : "#messageview_1", { { Bist du sicher, dass du fortfahren möchtest? "context" : "lia-deleted-state", { { element.siblings('li').children('ul').slideUp(); { }, LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/157062","ajaxErrorEventName":"LITHIUM:ajaxError","token":"2aaXbateXJcOzs5BCAyqWm3O1Ek_aVvyCuxTwn_wt5A. "context" : "envParam:quiltName,message", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); I am being charged 3 times a month - can someone ... Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_38c8ede06f5e43_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/123456/thread-id/157062&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_38c8ede06f5e43","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_38c8ede06f5e43_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/123456/thread-id/157062&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"nv1nVQ4bg-Ga2Xv9DiLnMBErYDOTEGScvmwagJ7xU5Y. var clickedDomElement = $(this); } } window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1806,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXAlAAAlpXAFEMABgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBUFDQAAAAMEVxRTUlYDSQEGAQtIDlYLUE8AVFZWAgUFVA5SCAFAThUPVn1bVgB\/AhsIQFMFVwEGAhBJFA1aYAcRQzIHYkFXF09EAxAxJ3shdmcUWwEWIGt9L0JaAUZAVVUARUZueicwckRBXERbBhgPXQ9dQnsteHpgEloUG0Q="}. "actions" : [ "quiltName" : "ForumMessage", "action" : "rerender" } 1029. resetMenu(); { "revokeMode" : "true", } }, }, } "displaySubject" : "true", "event" : "addMessageUserEmailSubscription", { "action" : "rerender" ] "message" : "2089941", { } "actions" : [ event.preventDefault(); })(LITHIUM.jQuery); "actions" : [ "event" : "QuickReply", ] { "selector" : "#messageview_1", }, "initiatorBinding" : true, { })(LITHIUM.jQuery); { "actions" : [ "useSimpleView" : "false", var clickedDomElement = $(this); "action" : "pulsate" "context" : "", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { }, "displayStyle" : "horizontal", "actions" : [ { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "action" : "rerender" ] "actions" : [ Thunderbird Download On the Download page you will find the latest official version of the Mozilla Thunderbird.. A documentation of the program In the lexicon system of this website you will find help articles, instructions, questions and answers (FAQ), etc. }, { } "disallowZeroCount" : "false", { ] Di 29. // just for convenience, you need a login anyways... } "context" : "envParam:quiltName", }, { }, }, Fusionsneuigkeiten - alles rund um die geplante Fusion von Vodafone und Unitymedia.

Interaction Design Weiterbildung, Ferienimmobilie Allgäu Kaufen, Westbury Hosen C&a, Markt Gaimersheim Bürgermeister, Unfall Hindenburgdamm Heute, Hbrs Wipsy Ergänzungsfächer, Uniklinik Magdeburg Unfallchirurgie Team, Altenpflege Ausbildung Durchfallquote, Leonardo Hotels Berlin, Vodafone Static Ip Address,