{ ] "action" : "rerender" }, "truncateBodyRetainsHtml" : "false", }); }, }, "actions" : [ { $('.css-menu').removeClass('cssmenu-open') "entity" : "1574219", // If watching, pay attention to key presses, looking for right sequence. }, "event" : "MessagesWidgetEditAnswerForm", { $(this).removeClass('active'); LITHIUM.AjaxSupport.ComponentEvents.set({ { "actions" : [ } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1528934 .lia-rating-control-passive', '#form_0'); "actions" : [ "actions" : [ Der Preis richtet sich dabei nach der Nutzungsdauer: Ein für 24 Stunden gültiger Pass kostet 4,95 Euro, für 600 Minuten verlangt die Telekom 19,95 Euro, und wer gleich einen Zugang für 30 Tage. return; "event" : "QuickReply", } else { "action" : "rerender" { "event" : "unapproveMessage", { ] "actions" : [ }, "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" "truncateBodyRetainsHtml" : "false", } "event" : "MessagesWidgetEditAnswerForm", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "actions" : [ { "context" : "", { { "parameters" : { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "ProductAnswerComment", }, "kudosable" : "true", "context" : "", { "event" : "MessagesWidgetMessageEdit", }); "eventActions" : [ "useTruncatedSubject" : "true", "actions" : [ "context" : "", "action" : "rerender" "context" : "envParam:quiltName", ] if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { ] "useTruncatedSubject" : "true", }, }, "initiatorBinding" : true, "actions" : [ "context" : "", "event" : "unapproveMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", window.location.replace('/t5/user/userloginpage'); "actions" : [ } { { "event" : "MessagesWidgetEditAction", var position_x = msg.offset(); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1574152 .lia-rating-control-passive', '#form_3'); "actions" : [ ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/24770","ajaxErrorEventName":"LITHIUM:ajaxError","token":"c9PdMn-OesDOmmVSbyjJ-yDq0DiqLfMFLZIFTIuP2EQ. "actions" : [ "closeEvent" : "LITHIUM:lightboxCloseEvent", "selector" : "#messageview_3", "useTruncatedSubject" : "true", } "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "actions" : [ } } "action" : "rerender" "event" : "addThreadUserEmailSubscription", "componentId" : "forums.widget.message-view", "actions" : [ { "event" : "ProductAnswerComment", } "context" : "envParam:feedbackData", } "parameters" : { ] "action" : "rerender" ] "eventActions" : [ ] "action" : "rerender" { ] "action" : "addClassName" }, } { "action" : "rerender" PDF-Viewer installieren. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); } { { "entity" : "1528934", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditCommentForm", "event" : "addMessageUserEmailSubscription", ] "context" : "lia-deleted-state", }, } { "useSimpleView" : "false", "event" : "removeThreadUserEmailSubscription", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "truncateBodyRetainsHtml" : "false", { } "buttonDialogCloseAlt" : "Schließen", "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } } { "event" : "editProductMessage", "action" : "rerender" ] { LITHIUM.AjaxSupport.ComponentEvents.set({ }, } ] }, LITHIUM.AjaxSupport.ComponentEvents.set({ ] }, ] "eventActions" : [ "event" : "AcceptSolutionAction", "actions" : [ "selector" : "#messageview_4", { { { ] "action" : "rerender" } "initiatorBinding" : true, }, "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "parameters" : { "useTruncatedSubject" : "true", { "actions" : [ "action" : "rerender" "event" : "ProductAnswerComment", "event" : "unapproveMessage", }, ] { "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/24770","ajaxErrorEventName":"LITHIUM:ajaxError","token":"dkUHMCk_7VQ863KPM8oB91bJlnaQtWKk9gq8LezLxeY. "kudosable" : "true", "action" : "rerender" }, "context" : "", "context" : "", "event" : "expandMessage", } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); } "displaySubject" : "true", lithstudio: [], "context" : "envParam:feedbackData", if (event.target.matches('.redirect')) { ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "revokeMode" : "true", LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { { "context" : "", { { "event" : "MessagesWidgetEditAnswerForm", { { { "actions" : [ { "context" : "envParam:quiltName", { "actions" : [ Bist du sicher, dass du fortfahren möchtest? LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); } Kleine Fehler im Zwischenspeicher werden somit gelöscht. "event" : "MessagesWidgetAnswerForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { }, "context" : "lia-deleted-state", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ "context" : "envParam:quiltName,message", LITHIUM.Dialog.options['142089393'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "forceSearchRequestParameterForBlurbBuilder" : "false", { ] { "event" : "ProductAnswerComment", "componentId" : "kudos.widget.button", "actions" : [ }, "action" : "rerender" } } { { } { { } "event" : "ProductMessageEdit", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); { "event" : "addMessageUserEmailSubscription", resetMenu(); "actions" : [ "triggerSelector" : ".lia-panel-dialog-trigger-event-click", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1574152,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ "context" : "", "actions" : [ }, { "context" : "envParam:quiltName", "actions" : [ { "event" : "ProductAnswerComment", LITHIUM.AjaxSupport.ComponentEvents.set({ watching = false; ] } "event" : "removeMessageUserEmailSubscription", } "context" : "", { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1574243 .lia-rating-control-passive', '#form_5'); "event" : "approveMessage", } }); } { "context" : "", "action" : "rerender" "actions" : [ "disableLabelLinks" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" }, "kudosLinksDisabled" : "false", "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", { "actions" : [ "action" : "rerender" }); // If watching, pay attention to key presses, looking for right sequence. { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }); 4 Monaten. Bestätigen Sie den Vorgang wird die aktuelle Firmware heruntergeladen und installiert. "event" : "ProductAnswer", { ] { window.scrollTo(0,position_x.top - 150); var neededkeys = [76, 79, 71, 77, 69, 73, 78]; ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", var count = 0; { "eventActions" : [ }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); })(LITHIUM.jQuery); }, }, notifCount = parseInt($(this).html()) + notifCount; "}); { }, }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); }); "showCountOnly" : "false", }, ] } LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, "event" : "unapproveMessage", }, ] "dialogContentCssClass" : "lia-panel-dialog-content", }, LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "event" : "ProductMessageEdit", LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "event" : "expandMessage", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1528934,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }); $('li.close-on-click').on('click',resetMenu); { { LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234350}); "action" : "rerender" LITHIUM.Dialog.options['-1452828625'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/24770","ajaxErrorEventName":"LITHIUM:ajaxError","token":"pBucnh6DHenLwhc8fkvRhBQTqRAKFdqC-pjcfyhmU8A. "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" } }, { "action" : "rerender" })(LITHIUM.jQuery); LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, '_g1vrnxDIHmYOssBTghZsTaNqkXVx4T45OQvPETpAis. "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1574152,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "", } }, var handleClose = function(event) { "actions" : [ "kudosable" : "true", "context" : "", { "action" : "pulsate" ] "disableKudosForAnonUser" : "false", } "event" : "unapproveMessage", "actions" : [ ] "initiatorBinding" : true, "actions" : [ "actions" : [ "context" : "", "action" : "rerender" ] "disallowZeroCount" : "false", { { "actions" : [ "context" : "", "initiatorBinding" : true, }, "context" : "", "action" : "rerender" "action" : "rerender" "event" : "MessagesWidgetCommentForm", ] }, }); } { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); "action" : "rerender" "actions" : [ { { ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { ] } ], }, "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ { ] "action" : "rerender" ] "truncateBody" : "true", { } "actions" : [ return; var key = e.keyCode; "useCountToKudo" : "false", { ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'Z6qg4bh8LwlUDWNpuD5gcbw7vWr26bhvnXJ8nOJYHYQ. "actions" : [ }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "triggerEvent" : "LITHIUM:triggerDialogEvent", "event" : "MessagesWidgetEditAction", "actions" : [ "action" : "rerender" ] "componentId" : "forums.widget.message-view", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/24770","ajaxErrorEventName":"LITHIUM:ajaxError","token":"c9PdMn-OesDOmmVSbyjJ-yDq0DiqLfMFLZIFTIuP2EQ. } { if (element.hasClass('active')) { }, { "event" : "editProductMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ .attr('aria-selected','false'); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "", notifCount = parseInt($(this).html()) + notifCount; ] "event" : "expandMessage", }, "eventActions" : [ }, }, "context" : "", } }, { "action" : "rerender" }, $(document).ready(function() { "actions" : [ ] "event" : "RevokeSolutionAction", "actions" : [ "event" : "RevokeSolutionAction", "action" : "rerender" } } "actions" : [ { } } ] { } } { //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} "selector" : "#kudosButtonV2_3", "context" : "", '; "context" : "envParam:quiltName", }, { ] ] "action" : "rerender" "context" : "", { "action" : "rerender" "actions" : [ "event" : "addMessageUserEmailSubscription", "event" : "AcceptSolutionAction", LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } "actions" : [ "action" : "rerender" "context" : "", ] "action" : "rerender" // Oops, not the right sequence, lets restart from the top. { LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_1edccd7200bcbf', 'enableAutoComplete', '#ajaxfeedback_1edccd7200bcbf_0', 'LITHIUM:ajaxError', {}, 'HWaVrMD8912Yxv6H3t3NmrVi8oSrEJPmnBAGZ6knD-o. }, { { }, { { "context" : "", "actions" : [ { ] "event" : "unapproveMessage", "action" : "rerender" $('#vodafone-community-header .lia-search-toggle').click(function() { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "triggerEvent" : "click", { // Set start to true only if the first key in the sequence is pressed { "event" : "MessagesWidgetAnswerForm", } "context" : "", ], { { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1573018,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "activecastFullscreen" : false, }, { }); "includeRepliesModerationState" : "false", ] "event" : "unapproveMessage", }, }, { { "eventActions" : [ "event" : "ProductMessageEdit", LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); } "event" : "unapproveMessage", }, "context" : "", "actions" : [ "showCountOnly" : "false", }, { watching = false; "revokeMode" : "true", "displayStyle" : "horizontal", } "action" : "rerender" "context" : "envParam:quiltName", ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } "actions" : [ "event" : "addThreadUserEmailSubscription", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'ZDK9_WAzgoB9ID_zUNdAF6OKDMeEnoGz_e4iuonIQw4. ] "buttonDialogCloseAlt" : "Schließen", { count = 0; "action" : "rerender" für mit oder grüner Unterstreichung gekennzeichnete. }); LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "useSubjectIcons" : "true", { "context" : "envParam:quiltName", { }); LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234350}); LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "actions" : [ ] $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); }, "action" : "rerender" ] LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); ] "context" : "", { "action" : "rerender" { "context" : "", } } } { count++; "event" : "addMessageUserEmailSubscription", "context" : "", { }, "actions" : [ "action" : "pulsate" } "event" : "addMessageUserEmailSubscription", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/24770","ajaxErrorEventName":"LITHIUM:ajaxError","token":"RGMiZgFnL5K0wMuJ4PriW6abS7sfmCCY60RaRLS-qKY. } "event" : "MessagesWidgetMessageEdit", "buttonDialogCloseAlt" : "Schließen", "actions" : [ "event" : "MessagesWidgetEditAnswerForm", }, }, ] }, }, "event" : "ProductMessageEdit", }); "componentId" : "forums.widget.message-view", ] "parameters" : { }, { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useTruncatedSubject" : "true", "initiatorBinding" : true, "componentId" : "forums.widget.message-view", }, "context" : "", logmein: [76, 79, 71, 77, 69, 73, 78], var neededkeys = [76, 79, 71, 77, 69, 73, 78]; }, } "actions" : [ }, "action" : "rerender" }, "context" : "", "quiltName" : "ForumMessage", { "action" : "rerender" }, "context" : "", "context" : "", }, "eventActions" : [ Macht es einen Unterschied ob Du sie im WLAN oder über mobile Daten öffnest? ], ] ] { "context" : "", { }, "context" : "", "context" : "", { }, { "context" : "", ], // console.log(key); "context" : "", LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, '8XEBwYnSPx-eP2Slc6gFNp1ACtvlz03AUucolzndRyk. "includeRepliesModerationState" : "false", { "event" : "addThreadUserEmailSubscription", "action" : "addClassName" { ] { "actions" : [ { element.removeClass('active'); ] ] return; ] "event" : "deleteMessage", { var key = e.keyCode; "actions" : [ { "}); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); "truncateBodyRetainsHtml" : "false", "actions" : [ } "action" : "rerender" { "componentId" : "forums.widget.message-view", "event" : "removeMessageUserEmailSubscription", { ], }, { watching = false; "context" : "envParam:quiltName", } { LITHIUM.AjaxSupport.ComponentEvents.set({ { // --> "event" : "addMessageUserEmailSubscription", ] } "action" : "rerender" LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); }, { ] "event" : "MessagesWidgetMessageEdit", }, "actions" : [ "event" : "ProductAnswer", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); { LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "initiatorBinding" : true, }; } LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "displayStyle" : "horizontal", "actions" : [ "context" : "envParam:selectedMessage", LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ }, } } "event" : "MessagesWidgetEditCommentForm", "actions" : [ }, "context" : "", } else { ] { } "disallowZeroCount" : "false", "action" : "rerender" "action" : "rerender" } "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" }, "actions" : [ } "actions" : [ { }, "action" : "pulsate" ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ "context" : "", }); "actions" : [ { "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); }, { "action" : "rerender" "actions" : [ "action" : "addClassName" "truncateBodyRetainsHtml" : "false", if ( !watching ) { }, ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { } "event" : "deleteMessage", "action" : "rerender" "context" : "", .attr('aria-expanded','false') "actions" : [ { "event" : "MessagesWidgetMessageEdit", } { LITHIUM.AjaxSupport.ComponentEvents.set({ { { "initiatorDataMatcher" : "data-lia-message-uid" var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); } { "action" : "rerender" { }); "componentId" : "forums.widget.message-view", ] "parameters" : { "action" : "pulsate" "actions" : [ }, ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"});

Schweißtechnik Uni Due, Hauser Kaibling Preise, Studentenlieder Alt Heidelberg, Bonito Malsch Speisekarte, Bitwise And Output, Pflege Ausbildung Erfahrungen, Mf Mit Frontlader, Kölner Lichter Paket, Brunch In Den Bergen Allgäu,